Proteintech, 27156-1-AP, ATM Polyclonal antibody

Size: 20ul / 150ul The ATM (27156-1-AP) by Proteintech is a Polyclonal antibody targeting ATM in WB, IHC, IP, ELISA applications with reactivity to human samples 27156-1-AP targets ATM in WB, IHC, IF, IP, ChIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, A549 cells, HeLa cells, HepG2 cells Positive IP detected in: HEK-293 cells Positive IHC detected in: human breast cancer tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information The ATM protein is a member of the phosphatidylinositol 3-kinase family of proteins that respond to DNA damage by phosphorylating key substrates involved in DNA repair and/or cell cycle control. It is involved in mitogenic signal transduction, meiotic recombination, detection of DNA damage, and cell cycle control. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25909 Product name: Recombinant human ATM protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1059-1361 aa of BC137169 Sequence: SSEFENKQALLKRAKEEVGLLREHKIQTNRYTVKVQRELELDELALRALKEDRKRFLCKAVENYINCLLSGEEHDMWVFRLCSLWLENSGVSEVNGMMKRDGMKIPTYKFLPLMYQLAARMGTKMMGGLGFHEVLNNLISRISMDHPHHTLFIILALANANRDEFLTKPEVARRSRITKNVPKQSSQLDEDRTEAANRIICTIRSRRPQMVRSVEALCDAYIILANLDATQWKTQRKGINIPADQPITKLKNLEDVVVPTMEIKVDHTGEYGNLVTIQSFKAEFRLAGGVNLPKIIDCVGSDG Predict reactive species Full Name: ataxia telangiectasia mutated Observed Molecular Weight: 310-350 kDa GenBank Accession Number: BC137169 Gene Symbol: ATM Gene ID (NCBI): 472 RRID: AB_2880780 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13315 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.