Iright
BRAND / VENDOR: Proteintech

Proteintech, 27160-1-AP, CPN2 Polyclonal antibody

CATALOG NUMBER: 27160-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CPN2 (27160-1-AP) by Proteintech is a Polyclonal antibody targeting CPN2 in WB, IHC, ELISA applications with reactivity to human samples 27160-1-AP targets CPN2 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human plasma Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Human carboxypeptidase N (CPN), a member of the CPN/E subfamily of "regulatory" metallo-carboxypeptidases, is an extracellular glycoprotein synthesized in the liver and secreted into the blood, where it controls the activity of vasoactive peptide hormones, growth factors and cytokines by specifically removing C-terminal basic residues. Normally, CPN circulates in blood plasma as a hetero-tetramer consisting of two 83 kDa (CPN2) domains each flanked by a 48 to 55 kDa catalytic (CPN1) domain (PMID:17157876). CPN2 also performs a crucial biological function in the invasion and migration of breast cancer and can be used as a biomarker for effective diagnosis and treatment of breast cancer. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25801 Product name: Recombinant human CPN2 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-180 aa of BC031569 Sequence: MLPGAWLLWTSLLLLARPAQPCPMGCDCFVQEVFCSDEELATVPLDIPPYTKNIIFVETSFTTLETRAFGSNPNLTKVVFLNTQLCQFRPDAFGGLPRLEDLEVTGSSFLNLSTNIFSNLTSLGKLTLNFNMLEALPEGLFQHLAALESLHLQGNQLQALPRRLFQPLTHLKTLNLAQNL Predict reactive species Full Name: carboxypeptidase N, polypeptide 2 Calculated Molecular Weight: 545 aa, 61 kDa Observed Molecular Weight: 83-90 kDa GenBank Accession Number: BC031569 Gene Symbol: CPN2 Gene ID (NCBI): 1370 RRID: AB_3085929 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P22792 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924