Proteintech, 27163-1-AP, IL-23R Polyclonal antibody

Size: 20ul / 150ul The IL-23R (27163-1-AP) by Proteintech is a Polyclonal antibody targeting IL-23R in WB, IHC, ELISA applications with reactivity to human, mouse samples 27163-1-AP targets IL-23R in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Jurkat cells, A431 cells, RAW 264.7 cells, Raji cells, THP-1 cells Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Interleukin-23 receptor (IL-23R) is a type I cytokine receptor that plays a critical role in immune responses and inflammation. It forms a receptor complex with IL-12Rβ1 and is activated by the cytokine IL-23, which is primarily produced by dendritic cells and activated macrophages (PMID: 39796684). The genetic and epigenetic interactions in the IL-23R/IL-17 axis are associated with elevated expression of IL-17 and inflammatory bowel disease (IBD) pathogenesis (PMID: 21672939). Specification Tested Reactivity: human, mouse Cited Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25939 Product name: Recombinant human IL-23R protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 31-130 aa of NM_144701 Sequence: MSGHIWVEPATIFKMGMNISIYCQAAIKNCQPRKLHFYKNGIKERFQITRINKTTARLWYKNFLEPHASMYCTAECPKHFQETLICGKDISSGYPPDIPDE Predict reactive species Full Name: interleukin 23 receptor Calculated Molecular Weight: 72 kDa Observed Molecular Weight: 65-75 kDa GenBank Accession Number: NM_144701 Gene Symbol: IL-23R Gene ID (NCBI): 149233 RRID: AB_2880783 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5VWK5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.