Proteintech, 27196-1-AP, PIM1 Polyclonal antibody

Size: 20ul / 150ul The PIM1 (27196-1-AP) by Proteintech is a Polyclonal antibody targeting PIM1 in WB, ELISA applications with reactivity to human, mouse samples 27196-1-AP targets PIM1 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: 3T3-L1 cells, LNCaP cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information PIM1 belongs to the Ser/Thr protein kinase family and the Pim subfamily. This family includes PIM1, PIM2, and PIM3, which share high sequence and structural similarity. PIM1 is a serine/threonine protein kinase that significantly promotes cell survival and proliferation, providing a selective advantage for tumorigenesis. PIM1 is expressed primarily in cells of the hematopoietic and germline lineages (PMID: 16186805). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25743 Product name: Recombinant human PIM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 244-313 aa of BC020224 Sequence: HDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPSK Predict reactive species Full Name: pim-1 oncogene Calculated Molecular Weight: 45 kDa Observed Molecular Weight: 30-40 kDa GenBank Accession Number: BC020224 Gene Symbol: PIM1 Gene ID (NCBI): 5292 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P11309 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.