Proteintech, 27214-1-AP, WNT2 Polyclonal antibody

Size: 20ul / 150ul The WNT2 (27214-1-AP) by Proteintech is a Polyclonal antibody targeting WNT2 in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 27214-1-AP targets WNT2 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue, MCF-7 cells Positive IHC detected in: rat brain tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Positive FC (Intra) detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information Wnt2 is a secreted glycoprotein that is one of the canonical Wnt ligands. The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. Wnt2 is known to directly regulate β-catenin activity, the key player in proliferation and inflammation. Recently, studies have demonstrated that Wnt2 is overexpressed in various human cancers, including esophageal, gastric, colorectal, breast, lung, cervical, and malignant glioma. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25845 Product name: Recombinant human WNT2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 231-270 aa of BC029854 Sequence: GDYLWRKYNGAIQVVMNQDGTGFTVANERFKKPTKNDLVY Predict reactive species Full Name: wingless-type MMTV integration site family member 2 Calculated Molecular Weight: 40 kDa Observed Molecular Weight: 34-40 kDa GenBank Accession Number: BC029854 Gene Symbol: WNT2 Gene ID (NCBI): 7472 RRID: AB_2880804 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P09544 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.