Iright
BRAND / VENDOR: Proteintech

Proteintech, 27223-1-AP, ELMO2 Polyclonal antibody

CATALOG NUMBER: 27223-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ELMO2 (27223-1-AP) by Proteintech is a Polyclonal antibody targeting ELMO2 in IP, ELISA applications with reactivity to human samples 27223-1-AP targets ELMO2 in IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive IP detected in: HEK-293 cells, BT-549 cells Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information ELMO2 (Engulfment and cell motility protein 2), a member of the Elmo protein family, has been implicated in the regulation of Rac1 and Akt activation. ELMO2 is recruited to the plasma membrane and involved in the signaling cascade that controls cytoskeleton dynamics and cell migration (PMID: 27226625). ELMO2 is a cytoskeletal adaptor protein necessary for cell migration and apoptotic cell removal. Loss-of-function mutations in ELMO2, via impaired RAC1 signaling and defective vascular smooth muscles, as the causative factor for autosomal-recessive VMOS (PMID: 27476657). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25832 Product name: Recombinant human ELMO2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-60 aa of BC000143 Sequence: MERTQSSNMETRLDAMKELAKLSADVTFATEFINMDGIIVLTRLVESGTKLLSHYSEMLA Predict reactive species Full Name: engulfment and cell motility 2 Calculated Molecular Weight: 80 kDa Observed Molecular Weight: 83 kDa GenBank Accession Number: BC000143 Gene Symbol: ELMO2 Gene ID (NCBI): 63916 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96JJ3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924