Product Description
Size: 20ul / 150ul
The Integrin alpha-5/CD49e (27224-1-AP) by Proteintech is a Polyclonal antibody targeting Integrin alpha-5/CD49e in WB, IHC, IP, ELISA applications with reactivity to human samples
27224-1-AP targets Integrin alpha-5/CD49e in WB, IHC, IP, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: A549 cells, HAP1 cells, HeLa cells, human placenta tissue, U2OS cells
Positive IP detected in: human placenta tissue
Positive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:1000-1:8000
Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC): IHC : 1:50-1:500
Specification
Tested Reactivity: human
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag26098 Product name: Recombinant human ITGA5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 874-995 aa of NM_002205 Sequence: PINPKGLELDPEGSLHHQQKREAPSRSSASSGPQILKCPEAECFRLRCELGPLHQQESQSLQLHFRVWAKTFLQREHQPFSLQCEAVYKALKMPYRILPRQLPQKERQVATAVQWTKAEGSY Predict reactive species
Full Name: integrin, alpha 5 (fibronectin receptor, alpha polypeptide)
Calculated Molecular Weight: 115 kDa
Observed Molecular Weight: 135-150 kDa
GenBank Accession Number: NM_002205
Gene Symbol: Integrin alpha 5
Gene ID (NCBI): 3678
RRID: AB_2880807
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P08648
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924