Iright
BRAND / VENDOR: Proteintech

Proteintech, 27237-1-AP, DACT1 Polyclonal antibody

CATALOG NUMBER: 27237-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DACT1 (27237-1-AP) by Proteintech is a Polyclonal antibody targeting DACT1 in WB, ELISA applications with reactivity to human samples 27237-1-AP targets DACT1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, A549 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information DACT1 (Dapper/Frodo) is a member of the Dapper family, which includes three genes: DACT1, DACT2 and DACT3. As a tumor suppressor, DACT1 is downregulated in multiple tumor types, such as liver, colon and breast cancer . DACT1 is an important modulator of Wnt signaling, interacting with key components of the various Wnt transduction pathways. For instance, DACT1 binds to disheveled homolog 1 (Dvl1) to induce the degradation of Dvl1 and the subsequent inhibition of the Wnt/β-catenin pathway . (PMID: 34252542, PMID: 29456669) Specification Tested Reactivity: human Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26096 Product name: Recombinant human DACT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 601-700 aa of NM_001079520 Sequence: VREKTRAGSKKCRFPDDLDTNKKLKKASSKGRKSGGGPEAGVPGRPAGGGHRAGSRAHGHGREAVVAKPKHKRTDYRRWKSSAEISYEEALRRARRGRRE Predict reactive species Full Name: dapper, antagonist of beta-catenin, homolog 1 (Xenopus laevis) Calculated Molecular Weight: 90 kDa Observed Molecular Weight: 90-100 kDa GenBank Accession Number: NM_001079520 Gene Symbol: DACT1 Gene ID (NCBI): 51339 RRID: AB_3085940 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NYF0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924