Iright
BRAND / VENDOR: Proteintech

Proteintech, 27266-1-AP, KMT2D Polyclonal antibody

CATALOG NUMBER: 27266-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The KMT2D (27266-1-AP) by Proteintech is a Polyclonal antibody targeting KMT2D in WB, IHC, ELISA applications with reactivity to human samples 27266-1-AP targets KMT2D in WB, IHC, IF, ChIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells Positive IHC detected in: human breast cancer tissue, human lymphoma tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information KMT2D (a COMPASS/ Set1 family member; also known as MLL4, ALR, and MLL2) is the biggest H3K4 methyltransferase among the most frequently mutated genes in many different types of cancer (PMID: 34194626). The enzymatic function of KMT2D depends on a cluster of C-terminal conserved domains, including a PHD domain, two FY-rich motifs (FYRC and FYRN) and a catalytic SET domain. KMT2D has two frequently occurring genomic alterations: truncation and missense mutations. Loss of KMT2D is a bona fide tumor suppressor gene in FL and DLBCL. Kmt2d perturbed the expression of genes that sustain proliferation and survival, and the KMT2D protein directly binds and associates with an active chromatin conformation in negative modulators of the BCR and lymphocyte migration pathways, which in turn could affect B cell responses to antigen(PMID: 26366712). Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26195 Product name: Recombinant human KMT2D protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 4821-4920 aa of NM_003482 Sequence: MESPARAGTEPKKGEAEGPGGKEKGLEGKSPDTGPDWLKQFDAVLPGYTLKSQLDILSLLKQESPAPEPPTQHSYTYNVSNLDVRQLSAPPPEEPSPPPSP Predict reactive species Full Name: myeloid/lymphoid or mixed-lineage leukemia 2 Calculated Molecular Weight: 593 kDa Observed Molecular Weight: 593 kDa GenBank Accession Number: NM_003482 Gene Symbol: KMT2D/MLL2 Gene ID (NCBI): 8085 RRID: AB_2880823 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O14686 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924