Iright
BRAND / VENDOR: Proteintech

Proteintech, 27267-1-AP, TMEM26 Polyclonal antibody

CATALOG NUMBER: 27267-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TMEM26 (27267-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM26 in WB, ELISA applications with reactivity to human samples 27267-1-AP targets TMEM26 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: L02 cells, HepG2 cells, Jurkat cells, MDA-MB-231 cells Recommended dilution Western Blot (WB): WB : 1:4000-1:8000 Background Information The Transmembrane protein 26 (TMEM26) gene encodes a protein containing multiple transmembrane fragments. Immunostaining indicated elevated TMEM26 expression in ESCC tumors. Various ESCC cell lines showed a high TMEM26 expression, where its plasma membrane localization was confirmed. The RNAi depletion of TMEM26 in TMEM26-high ESCC cells suppressed EMT-related alterations, including invasion, migration, and marker gene expression. Conversely, TMEM26 overexpression in TMEM26-low ESCC cells promoted these EMT-related alterations. Interestingly, TMEM26 depletion or overexpression did not affect cell growth, indicating its specific involvement in the EMT process. The animal study demonstrated the contributive role of TMEM26 in metastatic ESCC. Mechanistically, TMEM26 promoted NF-κB signaling to accelerate EMT in ESCC cells. The plasma membrane presentation and TJ protein assembly were impaired by TMEM26, which was likely to be another mechanism for EMT regulation by TMEM26 in ESCC. Therefore, TMEM26 disrupted TJ formation and promoted NF-κB signaling during the EMT activation in ESCC (PMID: 37611445). TMEM26 shows features for chain, glycosylation, modified residue (large scale data). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24409 Product name: Recombinant human TMEM26 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 84-188 aa of BC042872 Sequence: ELHHETQYCSIQAEGTSQNTSRKEDFNQTLTSNEQTSRADDLIETAKVFVNNLSTVCEKVWTLGLHQTFLLMLIIGRWLLPIGGGITRDQLSQLLLMFVGTAADI Predict reactive species Full Name: transmembrane protein 26 Calculated Molecular Weight: 368 aa, 42 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC042872 Gene Symbol: TMEM26 Gene ID (NCBI): 219623 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6ZUK4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924