Iright
BRAND / VENDOR: Proteintech

Proteintech, 27339-1-AP, MRPL35 Polyclonal antibody

CATALOG NUMBER: 27339-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MRPL35 (27339-1-AP) by Proteintech is a Polyclonal antibody targeting MRPL35 in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 27339-1-AP targets MRPL35 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse heart tissue, mouse liver tissue Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Mitochondrial ribosomal protein L35 (MRPL35) is a member of the large subunit family of mitochondrial ribosomal proteins. It plays a key role in the assembly of cytochrome C oxidase, involved in the translation of mitochondrial proteins. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26300 Product name: Recombinant human MRPL35 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 61-170 aa of BC020651 Sequence: TTSERNLTCGHTSVILNRMAPVLPSVLKLPVRSLTYFSARKGKRKTVKAVIDRFLRLHCGLWVRRKAGYKKKLWKKTPARKKRLREFVFCNKTQSKLLDKMTTSFWKRRN Predict reactive species Full Name: mitochondrial ribosomal protein L35 Calculated Molecular Weight: 170 aa, 19 kDa Observed Molecular Weight: 24 kDa GenBank Accession Number: BC020651 Gene Symbol: MRPL35 Gene ID (NCBI): 51318 RRID: AB_3669593 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NZE8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924