Proteintech, 27372-1-AP, CYSLTR1 Polyclonal antibody

Size: 20ul / 150ul The CYSLTR1 (27372-1-AP) by Proteintech is a Polyclonal antibody targeting CYSLTR1 in WB, ELISA applications with reactivity to human, mouse, rat samples 27372-1-AP targets CYSLTR1 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: rat heart tissue, mouse heart tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24961 Product name: Recombinant human CYSLTR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 252-337 aa of BC035750 Sequence: QRTIHLHFLHNETKPCDSVLTMQKSVVITLSLAASNCCFDPLLYFFSGGNFRKRLSTFRKHSLSSVTYVPRKKASLPEKGEEICKV Predict reactive species Full Name: cysteinyl leukotriene receptor 1 Calculated Molecular Weight: 39 kDa Observed Molecular Weight: 39 kDa GenBank Accession Number: BC035750 Gene Symbol: CYSLTR1 Gene ID (NCBI): 10800 RRID: AB_2880856 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y271 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.