Iright
BRAND / VENDOR: Proteintech

Proteintech, 27387-1-AP, ABI1 Polyclonal antibody

CATALOG NUMBER: 27387-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ABI1 (27387-1-AP) by Proteintech is a Polyclonal antibody targeting ABI1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 27387-1-AP targets ABI1 in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Neuro-2a cells, C2C12 cells, multi cells, HEK-293T cells, HepG2 cells, HEK 293 cells, Jurkat cells, mouse cerebellum tissue, rat cerebellum tissue Positive IHC detected in: mouse skin tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26537 Product name: Recombinant human ABI1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 265-379 aa of BC024254 Sequence: TIGPAAPGSAPGSQYGTMTRQISRHNSTTSSTSSGGYRRTPSVTAQFSAQPHVNGGPLYSQNSISIAPPPPPMPQLTPQIPLTGFVARVQENIADSPTPPPPPPPDDIPMFDDSP Predict reactive species Full Name: abl-interactor 1 Calculated Molecular Weight: 507 aa, 55 kDa Observed Molecular Weight: 55-60 kDa GenBank Accession Number: BC024254 Gene Symbol: ABI1 Gene ID (NCBI): 10006 RRID: AB_2880860 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IZP0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924