Iright
BRAND / VENDOR: Proteintech

Proteintech, 27392-1-AP, OTULIN Polyclonal antibody

CATALOG NUMBER: 27392-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The OTULIN (27392-1-AP) by Proteintech is a Polyclonal antibody targeting OTULIN in WB, ELISA applications with reactivity to human samples 27392-1-AP targets OTULIN in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293T cells, HeLa cells, Jurkat cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information Linear ubiquitination is negatively regulated by OTULIN (OTU deubiquitinase with linear linkage specificity, also known as Fam105b or Gumby), a deubiquitinase specifically catalysing the degradation of linear ubiquitin chains. OUb signalling is antagonised by deubiquitinases (DUBs), which cleave the polyUb signal from substrates to terminate signalling. OTU DUB with linear linkage specificity (OTULIN) and CYLD are the two main DUBs that regulate M1-polyUb signalling. OTULIN exclusively cleaves M1 linkages, whereas CYLD cleaves both M1 and K63 linkages. OTULIN binds directly to the LUBAC subunit HOIP and regulates LUBAC signalling, autoubiquitination, and stability.(PMID: 34625557, PMID: 32231246) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22302 Product name: Recombinant human FAM105B protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-214 aa of BC007706 Sequence: MSQAVGLPPWLQDPELMLLPEKLISKYNWIKQWKLGLKFDGKNEDLVDKIKESLTLLRKKWAGLAEMRTAEARQIACDELFTNEAEEYSLYEAVKFLMLNRAIELYNDKEKGKEVPFFSVLLFARDTSNDPGQLLRNHLNQVGHTGGLEQVEMFLLAYAVRHTIQVYRLSKYNTEEFITVYPTDPPKDWPVVTLIAEDDRHYNIPVRVCEETSL Predict reactive species Full Name: family with sequence similarity 105, member B Calculated Molecular Weight: 352 aa, 40 kDa Observed Molecular Weight: 40-50 kDa GenBank Accession Number: BC007706 Gene Symbol: FAM105B Gene ID (NCBI): 90268 RRID: AB_3085952 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96BN8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924