Proteintech, 27414-1-AP, SOX4 Polyclonal antibody

Size: 20ul / 150ul The SOX4 (27414-1-AP) by Proteintech is a Polyclonal antibody targeting SOX4 in WB, ELISA applications with reactivity to human samples 27414-1-AP targets SOX4 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, HL-60 cells, HepG2 cells, K-562 cells, MDA-MB-231 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information SOX4 is a member of the SOX (SRY-related HMG-box) family of transcription factors that play key roles in the regulation of stemness, differentiation, progenitor cell development, and multiple developmental pathways. A single-exon gene encodes the SOX4 protein and contains a highly conserved high-mobility group (HMG) DNA binding domain related to the TCF/LEF family of transcription factors that play important roles in the Wnt pathway. SOX4 is expressed in stem cells, and modulates stem cell activation and likely also plays a role in stem cell maintenance, possibly through activation of expression of SOX2 (PMID: 23764001, 31445218). The calculated molecular weight of SOX4 is 47 kDa. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26583 Product name: Recombinant human SOX4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 70-160 aa of BC072668 Sequence: SQIERRKIMEQSPDMHNAEISKRLGKRWKLLKDSDKIPFIREAERLRLKHMADYPDYKYRPRKKVKSGNANSSSSAAASSKPGEKGDKVGG Predict reactive species Full Name: SRY (sex determining region Y)-box 4 Calculated Molecular Weight: 474 aa, 47 kDa Observed Molecular Weight: 47 kDa GenBank Accession Number: BC072668 Gene Symbol: SOX4 Gene ID (NCBI): 6659 RRID: AB_3085955 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q06945 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.