Iright
BRAND / VENDOR: Proteintech

Proteintech, 27424-1-AP, WDR91 Polyclonal antibody

CATALOG NUMBER: 27424-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The WDR91 (27424-1-AP) by Proteintech is a Polyclonal antibody targeting WDR91 in WB, ELISA applications with reactivity to human samples 27424-1-AP targets WDR91 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, Jurkat cells, SH-SY5Y cells, U2OS cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information WDR91 (1-405 aa) can be detected 42 kDa (PMID:28860274). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26697 Product name: Recombinant human WDR91 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 178-365 aa of BC017246 Sequence: FDAECQRTNQVQEENEVLRQKLFALQAEIHRLKKEEQQPEEEEALVQHKLPPYVSNMDRLGDSELAMVCSQRNASLSQSPRVGFLSSLLPQSKKSPSRLSPAQGPPQPQSSAKKESFGGQGTKGKDPTSGAKDGKSLLSGLATGESGWSQHRQRRLQDHGKERKELFSTTTSQCAEKKPEASGPEAEP Predict reactive species Full Name: WD repeat domain 91 Observed Molecular Weight: 42 kDa, 83 kDa GenBank Accession Number: BC017246 Gene Symbol: WDR91 Gene ID (NCBI): 29062 RRID: AB_3669601 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: A4D1P6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924