Iright
BRAND / VENDOR: Proteintech

Proteintech, 27426-1-AP, NPPA Polyclonal antibody

CATALOG NUMBER: 27426-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NPPA (27426-1-AP) by Proteintech is a Polyclonal antibody targeting NPPA in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 27426-1-AP targets NPPA in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse heart tissue, rat heart tissue Positive IHC detected in: mouse heart tissue, human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: C2C12 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Natriuretic peptide precursor-A (NPPA) is an early and specific marker for functional myocardium of the embryonic heart. This protein is synthesized as a large precursor (containing a signal peptide), which is processed to release a peptide from the N-terminus with similarity to vasoactive peptide, cardiodilatin, and another peptide from the C-terminus with natriuretic-diuretic activity. NPPA is expressed primarily in the heart, where the expression level is higher in atria than ventricles. Low levels of ANP expression have been detected in other tissues, including the lung, aorta, brain, adrenal gland, kidney and uterus. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, goat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26692 Product name: Recombinant human NPPA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 26-153 aa of BC005893 Sequence: NPMYNAVSNADLMDFKNLLDHLEEKMPLEDEVVPPQVLSEPNEEAGAALSPLPEVPPWTGEVSPAQRDGGALGRGPWDSSDRSALLKSKLRALLTAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRYRR Predict reactive species Full Name: natriuretic peptide precursor A Calculated Molecular Weight: 153 aa, 17 kDa Observed Molecular Weight: 19 kDa GenBank Accession Number: BC005893 Gene Symbol: NPPA Gene ID (NCBI): 4878 RRID: AB_2880868 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P01160 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924