Iright
BRAND / VENDOR: Proteintech

Proteintech, 27429-1-AP, TXNIP Polyclonal antibody

CATALOG NUMBER: 27429-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TXNIP (27429-1-AP) by Proteintech is a Polyclonal antibody targeting TXNIP in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 27429-1-AP targets TXNIP in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, MCF-7 cells, RAW 264.7 cells Positive IHC detected in: mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information TXNIP, also known as VDUP-1 or TBP-2, belongs to alpha-arrestin protein family and is perhaps the only family member known to bind thioredoxin (TRX). TXNIP was induced by Vitamin D3, but not induced by another monocyte or macrophage differentiation inducer: phorbol 12-myristate 13-acetate (PMA). TXNIP bound catalytic active center of thioredoxin (TRX), which protected cells against oxidative stress. TXNIP was found to be a negative regulator of thioredoxin activity and inducer of the intracellular level of reactive oxygen species (ROS). TXNIP plays an important role in a wide variety of biological functions, such as the regulation of cell death, growth, differentiation, and energy metabolism. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26579 Product name: Recombinant human TXNIP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 59-206 aa of BC093702 Sequence: GSQQCKQTSEYLRYEDTLLLEDQPTGENEMVIMRPGNKYEYKFGFELPQGPLGTSFKGKYGCVDYWVKAFLDRPSQPTQETKKNFEVVDLVDVNTPDLMAPVSAKKEKKVSCMFIPDGRVSVSARIDRKGFCEGDEISIHADFENTCS Predict reactive species Full Name: thioredoxin interacting protein Calculated Molecular Weight: 391 aa, 44 kDa Observed Molecular Weight: 44-55 kDa GenBank Accession Number: BC093702 Gene Symbol: TXNIP Gene ID (NCBI): 10628 RRID: AB_3085957 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H3M7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924