Iright
BRAND / VENDOR: Proteintech

Proteintech, 27433-1-AP, TUBD1 Polyclonal antibody

CATALOG NUMBER: 27433-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TUBD1 (27433-1-AP) by Proteintech is a Polyclonal antibody targeting TUBD1 in WB, ELISA applications with reactivity to human samples 27433-1-AP targets TUBD1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, Jurkat cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information TUBD1, also named as TUBD, Tubulin delta chain, tubulin delta 1. The TUBD1 gene encodes a centrosomal protein of 453-amino acids with a molecular mass of 51 kD containing the canonical GTP-binding domain shared with other tubulins. TUBD1 mRNA is preferentially expressed in the sperm head, but it has been also detected in retina, heart, muscle, thyroid, ovary, and colon, among other tissues. At least 6 isoforms of the human protein are produced by alternative splicing (PMID: 28137601). The molecular weights of these 6 isoforms are 51, 45, 22, 27, 44, and 40 kDa, respectively. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26626 Product name: Recombinant human TUBD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-134 aa of BC000258 Sequence: LSDSHSSQGLCSMRENEAYQASCKERFFSEEENGVPIARAVLVDMEPKVINQMLSKAAQSGQWKYGQHACFCQKQGSGNNWAYGYSVHGPRHEESIMNIIRKEVEKCDSFS Predict reactive species Full Name: tubulin, delta 1 Calculated Molecular Weight: 51 kDa Observed Molecular Weight: 44 kda GenBank Accession Number: BC000258 Gene Symbol: TUBD1 Gene ID (NCBI): 51174 RRID: AB_3669602 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UJT1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924