Proteintech, 27449-1-AP, SELENBP1 Polyclonal antibody

Size: 20ul / 150ul The SELENBP1 (27449-1-AP) by Proteintech is a Polyclonal antibody targeting SELENBP1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 27449-1-AP targets SELENBP1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, mouse liver tissue, L02 cells, MCF-7 cells Positive IHC detected in: human liver cancer tissue, human colon tissue, rat liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information SELENBP1 (selenium binding protein 1,SBP1), also known as LPSB or SP56, is a 472 amino acid peripheral membrane protein that binds selenium covalently. Selenium, an essential trace element, has been shown to have an anti-cancer effect. Many reports have described a relationship between insufficient selenium intake and increased risk of cancer. Moreover, the expression of SELENBP1 has been shown to be decreased in several tumors including cancers of the prostate, lungs, colon, and ovary (PMID: 21143902, 20332323, 18272210). SELENBP1 has four isoforms with the molecular mass of 56kD, 52kD and 45kD. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24453 Product name: Recombinant human SELENBP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 121-472 aa of BC009084 Sequence: VIEPKDIHAKCELAFLHTSHCLASGEVMISSLGDVKGNGKGGFVLLDGETFEVKGTWERPGGAAPLGYDFWYQPRHNVMISTEWAAPNVLRDGFNPADVEAGLYGSHLYVWDWQRHEIVQTLSLKDGLIPLEIRFLHNPDAAQGFVGCALSSTIQRFYKNEGGTWSVEKVIQVPPKKVKGWLLPEMPGLITDILLSLDDRFLYFSNWLHGDLRQYDISDPQRPRLTGQLFLGGSIVKGGPVQVLEDEELKSQPEPLVVKGKRVAGGPQMIQLSLDGKRLYITTSLYSAWDKQFYPDLIREGSVMLQVDVDTVKGGLKLNPNFLVDFGKEPLGPALAHELRYPGGDCSSDIWI Predict reactive species Full Name: selenium binding protein 1 Calculated Molecular Weight: 52 kDa Observed Molecular Weight: 56 kDa GenBank Accession Number: BC009084 Gene Symbol: SELENBP1 Gene ID (NCBI): 8991 RRID: AB_2880872 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13228 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.