Iright
BRAND / VENDOR: Proteintech

Proteintech, 27470-1-AP, KIFC2 Polyclonal antibody

CATALOG NUMBER: 27470-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The KIFC2 (27470-1-AP) by Proteintech is a Polyclonal antibody targeting KIFC2 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 27470-1-AP targets KIFC2 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Kinesin family member C2 (KIFC2), one of the kinesin-14 motor family members, is especially expressed in neurons and is important for organizing dendritic microtubules and to control dendrite development (PMID: 37716704). KIFC2 is a microtubule-binding protein that functions as a motor protein in vesicle transport along axons and/or dendrites. Western blot analysis detected KIFC2 at an apparent molecular mass of 96 kD(PMID: 9115737). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26519 Product name: Recombinant human KIFC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 132-254 aa of BC017311 Sequence: RSPRGRQALLQGTQPAPRVRPPSPDGSTSQEESPSHFTAVPGEPLGDETQGQQPLQLEEDQRAWQRLEQLILGQLEELKQQLEQQEEELGRLRLGVGATDSEKRVQHLTLENEALKQSLSLMR Predict reactive species Full Name: kinesin family member C2 Calculated Molecular Weight: 90 kDa Observed Molecular Weight: 96 kDa GenBank Accession Number: BC017311 Gene Symbol: KIFC2 Gene ID (NCBI): 90990 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96AC6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924