Iright
BRAND / VENDOR: Proteintech

Proteintech, 27477-1-AP, Kininogen 1 Polyclonal antibody

CATALOG NUMBER: 27477-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Kininogen 1 (27477-1-AP) by Proteintech is a Polyclonal antibody targeting Kininogen 1 in WB, IHC, ELISA applications with reactivity to human samples 27477-1-AP targets Kininogen 1 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A2780 cells, HeLa cells, HepG2 cells Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Kininogens are inhibitors of thiol proteases. Kininogen 1 plays important role in Kinin-kallikrein system. This gene is translated into High-molecular weight kininogen (HMWK) and low-molecular weight kininogen (LMWK) after alternative splicing. HMWK is produced by the liver together with prekallikrein. It acts mainly as a cofactor on coagulation and inflammation, and has no intrinsic catalytic activity. LMWK is produced locally by numerous tissues, and secreted together with tissue kallikrein. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26467 Product name: Recombinant human KNG1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 20-200 aa of BC060039 Sequence: ESQSEEIDCNDKDLFKAVDAALKKYNSQNQSNNQFVLYRITEATKTVGSDTFYSFKYEIKEGDCPVQSGKTWQDCEYKDAAKAATGECTATVGKRSSTKFSVATQTCQITPAEGPVVTAQYDCLGCVHPISTQSPDLEPILRHGIQYFNNNTQHSSLFMLNEVKRAQRQVVAGLNFRMTYS Predict reactive species Full Name: kininogen 1 Calculated Molecular Weight: 644 aa, 72 kDa Observed Molecular Weight: 70-72 kDa GenBank Accession Number: BC060039 Gene Symbol: Kininogen 1 Gene ID (NCBI): 3827 RRID: AB_2880882 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P01042 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924