Iright
BRAND / VENDOR: Proteintech

Proteintech, 27494-1-AP, GTF3C2 Polyclonal antibody

CATALOG NUMBER: 27494-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GTF3C2 (27494-1-AP) by Proteintech is a Polyclonal antibody targeting GTF3C2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 27494-1-AP targets GTF3C2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293T cells, A549 cells, HeLa cells, HepG2 cells, MCF-7 cells, PC-3 cells Positive IHC detected in: human thyroid cancer tissue, human cervical cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information GTF3C2, also named as KIAA0011, is a 911 amino acid protein, which localizes in the nucleus. GTF3C2 is required for RNA polymerase III-mediated transcription. GTF3C2 is a component of TFIIIC that initiates transcription complex assembly on tRNA and is required for transcription of 5S rRNA and other stable nuclear and cytoplasmic RNAs. GTF3C2 may play a direct role in stabilizing interactions of TFIIIC2 with TFIIIC1. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26666 Product name: Recombinant human GTF3C2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 59-188 aa of BC020981 Sequence: GFEDSPDQRRLPPEQESLSRLEQPDLSSEMSKVSKPRASKPGRKRGGRTRKGPKRPQQPNPPSAPLVPGLLDQSNPLSTPMPKKRGRKSKAELLLLKLSKDLDRPESQSPKRPPEDFETPSGERPRRRAA Predict reactive species Full Name: general transcription factor IIIC, polypeptide 2, beta 110kDa Calculated Molecular Weight: 101 kDa Observed Molecular Weight: 100-110 kDa GenBank Accession Number: BC020981 Gene Symbol: GTF3C2 Gene ID (NCBI): 2976 RRID: AB_2880889 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WUA4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924