Iright
BRAND / VENDOR: Proteintech

Proteintech, 27498-1-AP, CLUL1 Polyclonal antibody

CATALOG NUMBER: 27498-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CLUL1 (27498-1-AP) by Proteintech is a Polyclonal antibody targeting CLUL1 in WB, ELISA applications with reactivity to human samples 27498-1-AP targets CLUL1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: ARPE-19 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information Clusterin-like protein 1 (CLUL1) functions as a molecular chaperone, protecting stressed proteins, and is upregulated in various neurodegenerative conditions, suggesting a role in defense against neuronal damage (PMID: 17148042). It is specifically expressed in cone photoreceptor cells and is regulated by the cone-rod homeobox (CRX) (PMID: 14507903). Mutations of CLUL1 were investigated in the context of age-related macular degeneration (AMD), a leading cause of blindness in the elderly (PMID: 17148042). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26570 Product name: Recombinant human CLUL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 21-124 aa of BC025381 Sequence: APTWKDKTAISENLKSFSEVGEIDADEEVKKALTGIKQMKIMMERKEKEHTNLMSTLKKCREEKQEALKLLNEVQEHLEEEERLCRESLADSWGECRSCLENNC Predict reactive species Full Name: clusterin-like 1 (retinal) Calculated Molecular Weight: 54 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC025381 Gene Symbol: CLUL1 Gene ID (NCBI): 27098 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15846 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924