Iright
BRAND / VENDOR: Proteintech

Proteintech, 27504-1-AP, PSMD8 Polyclonal antibody

CATALOG NUMBER: 27504-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PSMD8 (27504-1-AP) by Proteintech is a Polyclonal antibody targeting PSMD8 in WB, IF/ICC, ELISA applications with reactivity to Human, Mouse samples 27504-1-AP targets PSMD8 in WB, IF/ICC, ELISA applications and shows reactivity with Human, Mouse samples. Tested Applications Positive WB detected in: NIH/3T3 cells Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information The Proteasome 26S Subunit, Non-ATPase (PSMD) gene family, which includes the PSMD1 to PSMD14, regulate ubiqutinated protein breakdown in circulation as well as tumorigenesis. Studies have shown that PSMD8 interacts with the sperm adhesin AQN1 to limit polyfertilization. PSMD8 was more expressed in normal skeletal muscle, cardiac muscle, and tongue muscle; among malignant tumors, PSMD8 was expressed in ovarian cancer, testicular cancer, glioma, and melanoma(PMID:37349676). Specification Tested Reactivity: Human, Mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26567 Product name: Recombinant human PSMD8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-130 aa of BC001164 Sequence: MYEQLKGEWNRKSPNLSKCGEELGRLKLVLLELNFLPTTGTKLTKQQLILARDILEIGAQWSILRKDIPSFERYMAQLKCYYFDYKEQLPESAYMHQLLGLNLLFLLSQNRVAEFHTELERLPAKDIQTN Predict reactive species Full Name: proteasome (prosome, macropain) 26S subunit, non-ATPase, 8 Calculated Molecular Weight: 257 aa, 30 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC001164 Gene Symbol: PSMD8 Gene ID (NCBI): 5714 RRID: AB_3669605 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P48556 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924