Iright
BRAND / VENDOR: Proteintech

Proteintech, 27506-1-AP, IFN-beta Polyclonal antibody

CATALOG NUMBER: 27506-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The IFN-beta (27506-1-AP) by Proteintech is a Polyclonal antibody targeting IFN-beta in WB, IF/ICC, ELISA applications with reactivity to human samples 27506-1-AP targets IFN-beta in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Recombinant protein Positive IF/ICC detected in: HepG2 cells, L02 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Interferon-beta (IFN-β) is a type I interferon, which is a group of signaling proteins made and released by host cells in response to the presence of several viruses, including double-stranded RNA produced by many viruses. IFN-β is a single protein species and is molecularly related to IFN-α subtypes, although it is antigenically distinct from them. It is mainly produced by fibroblasts and plays a crucial role in the innate immune response against viruses. IFN-β can inhibit viral replication by interfering with the virus's RNA or DNA, thus suppressing viral growth. It also enhances the cytotoxic activity of natural killer (NK) cells and promotes the expression of major histocompatibility complex (MHC) class I molecules. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26326 Product name: Recombinant human IFNB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 22-187 aa of BC069314 Sequence: MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN Predict reactive species Full Name: IFN beta Calculated Molecular Weight: 187 aa, 22 kDa GenBank Accession Number: BC069314 Gene Symbol: IFN beta1 Gene ID (NCBI): 3456 RRID: AB_2880893 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P01574 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924