Iright
BRAND / VENDOR: Proteintech

Proteintech, 27508-1-AP, IRS2 Polyclonal antibody

CATALOG NUMBER: 27508-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The IRS2 (27508-1-AP) by Proteintech is a Polyclonal antibody targeting IRS2 in IHC, IF-P, ELISA applications with reactivity to human, mouse samples 27508-1-AP targets IRS2 in IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brain tissue Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information IRS2 (Insulin Receptor Substrate 2) is a widely expressed cytoplasmic adaptor protein and a member of the insulin receptor substrate (IRS) family. It plays a critical role in insulin and insulin-like growth factor-1 (IGF-1) signaling pathways. IRS2 is involved in a variety of biological processes, including metabolic regulation, cell growth, tumor metabolism, and immune responses. Through its N-terminal PH domain and PTB domain, IRS2 binds to activated insulin receptor (IR) or IGF-1 receptor (IGF-1R). Upon phosphorylation, it recruits and activates downstream signaling molecules such as PI3K, Grb2, and SHP2, thereby regulating cellular metabolism, proliferation, survival, and migration. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26427 Product name: Recombinant human IRS2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 507-606 aa of NM_003749 Sequence: MPGDLRAFCSHRSNTPESIAETPPARDGGGGGEFYGYMTMDRPLSHCGRSYRRVSGDAAQDLDRGLRKRTYSLTTPARQRPVPQPSSASLDEYTLMRATFS Predict reactive species Full Name: IRS2 Calculated Molecular Weight: 137 kDa Observed Molecular Weight: 160-190 kDa GenBank Accession Number: NM_003749 Gene Symbol: IRS2 Gene ID (NCBI): 8660 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y4H2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924