Proteintech, 27515-1-AP, KLK15 Polyclonal antibody

Size: 20ul / 150ul The KLK15 (27515-1-AP) by Proteintech is a Polyclonal antibody targeting KLK15 in WB, IHC, ELISA applications with reactivity to Human samples 27515-1-AP targets KLK15 in WB, IHC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: SMMC-7721 cells Positive IHC detected in: human liver cancer tissue, human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:200 Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26232 Product name: Recombinant human KLK15 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 109-188 aa of BC069480 Sequence: LRLVQPARLNPQVRPAVLPTRCPHPGEACVVSGWGLVSHNEPGTAGSPRSQVSLPDTLHCANISIISDTSCDKSYPGRLT Predict reactive species Full Name: kallikrein-related peptidase 15 Calculated Molecular Weight: 255 aa, 28 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: BC069480 Gene Symbol: KLK15 Gene ID (NCBI): 55554 RRID: AB_2880895 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H2R5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.