Iright
BRAND / VENDOR: Proteintech

Proteintech, 27519-1-AP, CD48 Polyclonal antibody

CATALOG NUMBER: 27519-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CD48 (27519-1-AP) by Proteintech is a Polyclonal antibody targeting CD48 in WB, IHC, ELISA applications with reactivity to human samples 27519-1-AP targets CD48 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Daudi cells, Raji cells, Ramos cells Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Background Information Signaling lymphocytic activation molecule family 2 (SLAMF2, CD48) is an adhesion and costimulatory molecule expressed constitutively on most hematopoietic cells, particularly in antigen-presenting cells (APC). CD48 is expressed on all the hematopoietic cells, both in humans and mice, except for murine neutrophils and long-term HSC. CD48 exists as both a membrane-bound (mCD48) and a soluble (sCD48) form. CD48 can activate T cells, antigen-presenting cells and granulocytes, by binding to CD2 or bacterial FimH, and through cell intrinsic effects. Interactions between CD48 and its high-affinity ligand CD244 are more complex, with both stimulatory and inhibitory outcomes. CD48 expression is increased in autoimmunity and allergy diseases, and anti-CD48 monoclonal antibodies have been shown to attenuate experimental autoimmune encephalomyelitis. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26536 Product name: Recombinant human CD48 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 27-220 aa of BC016182 Sequence: QGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARS Predict reactive species Full Name: CD48 molecule Calculated Molecular Weight: 43 kDa Observed Molecular Weight: 38-45 kDa GenBank Accession Number: BC016182 Gene Symbol: CD48 Gene ID (NCBI): 962 RRID: AB_2880897 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P09326 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924