Iright
BRAND / VENDOR: Proteintech

Proteintech, 27530-1-AP, ADAM32 Polyclonal antibody

CATALOG NUMBER: 27530-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ADAM32 (27530-1-AP) by Proteintech is a Polyclonal antibody targeting ADAM32 in WB, ELISA applications with reactivity to human, mouse, rat samples 27530-1-AP targets ADAM32 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, rat testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information ADAM32 may play a role in sperm development and fertilization and it is a non-catalytic metalloprotease-like protein. In mature sperm from cauda epididymis and vas deferens, a band of 44 kDa for ADAM32 is detected and indicates that ADAM32 is made as precursors and processed to lower molecular-weight forms during sperm maturation in the epididymis(PMID:16407499). The full length protein has a signal peptide, a propeptide and 4 glycosylation sites. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26450 Product name: Recombinant human ADAM32 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 704-787 aa of BC026169 Sequence: RKQLKKWFAKEEEFPSSESKSEGSTQTYASQSSSEGSTQTYASQTRSESSSQADTSKSKSEDSAEAYTSRSKSQDSTQTQSSSN Predict reactive species Full Name: ADAM metallopeptidase domain 32 Calculated Molecular Weight: 787 aa, 88 kDa Observed Molecular Weight: 80 kDa GenBank Accession Number: BC026169 Gene Symbol: ADAM32 Gene ID (NCBI): 203102 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TC27 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924