Iright
BRAND / VENDOR: Proteintech

Proteintech, 27578-1-AP, UST Polyclonal antibody

CATALOG NUMBER: 27578-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The UST (27578-1-AP) by Proteintech is a Polyclonal antibody targeting UST in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 27578-1-AP targets UST in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HT-29 cells, SW480 cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U-251 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information UST (Uronyl 2-sulfotransferase) is an enzyme that catalyzes the transfer of sulfate groups to the 2-position of uronyl residues, such as iduronyl residues in dermatan sulfate and glucuronyl residues in chondroitin sulfate (PMID: 10187838). UST is a critical regulator of melanoma cell adhesion and motility in vitro and in vivo. Abnormal expression or activity of UST has also been associated with certain diseases, such as breast pericanalicular fibroadenoma and acute retinal necrosis (PMID: 25480151). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25483 Product name: Recombinant human UST protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 72-406 aa of BC093668 Sequence: PRFLLDLRQYLGNSTYLDDHGPPPSKVLPFPSQVVYNRVGKCGSRTVVLLLRILSEKHGFNLVTSDIHNKTRLTKNEQMELIKNISTAEQPYLFTRHVHFLNFSRFGGDQPVYINIIRDPVNRFLSNYFFRRFGDWRGEQNHMIRTPSMRQEERYLDINECILENYPECSNPRLFYIIPYFCGQHPRCREPGEWALERAKLNVNENFLLVGILEELEDVLLLLERFLPHYFKGVLSIYKDPEHRKLGNMTVTVKKTVPSPEAVQILYQRMRYEYEFYHYVKEQFHLLKRKFGLKSHVSKPPLRPHFFIPTPLETEEPIDDEEQDDEKWLEDIYKR Predict reactive species Full Name: uronyl-2-sulfotransferase Calculated Molecular Weight: 406 aa, 48 kDa Observed Molecular Weight: 48 kDa GenBank Accession Number: BC093668 Gene Symbol: UST Gene ID (NCBI): 10090 RRID: AB_3669611 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y2C2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924