Iright
BRAND / VENDOR: Proteintech

Proteintech, 27583-1-AP, TRANK1 Polyclonal antibody

CATALOG NUMBER: 27583-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TRANK1 (27583-1-AP) by Proteintech is a Polyclonal antibody targeting TRANK1 in WB, ELISA applications with reactivity to Human samples 27583-1-AP targets TRANK1 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: Raji cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information Etratricopeptide repeat and ankyrin repeat containing 1 (TRANK1), has been confirmed as the susceptibility gene for BD (bipolar disorder). An integrated analysis of mRNA co-expression networks revealed that genes highly correlated with TRANK1 were significantly involved in the biological processes related to synaptic plasticity, dendritic spine, axon guidance and circadian rhythm. In addition, TRANK1 rs71947856 variant was associated with circadian regulation and Kleine-Levin syndrome, which is a rare disease characterized by severe episodic hypersomnia, with cognitive impairment and apathy or disinhibition.(PMID: 34014031) Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26206 Product name: Recombinant human TRANK1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 901-1000 aa of NM_014831 Sequence: MVLDHCKLADSIKAICNAYNRGLSCVLRKKLKGINKGQVSANMKIQKRIPRCYVEDTEAEKGREHVNPEYFPPASAVETEYNIMKFHSFSTNMAFNILNDT Predict reactive species Full Name: lupus brain antigen 1 Calculated Molecular Weight: 336 kDa Observed Molecular Weight: ~330 kDa GenBank Accession Number: NM_014831 Gene Symbol: LBA1 Gene ID (NCBI): 9881 RRID: AB_3669612 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O15050 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924