Iright
BRAND / VENDOR: Proteintech

Proteintech, 27590-1-AP, ZNF653 Polyclonal antibody

CATALOG NUMBER: 27590-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ZNF653 (27590-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF653 in WB, IHC, ELISA applications with reactivity to human, mouse samples 27590-1-AP targets ZNF653 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: human plasma sample Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information ZNF653, also named ZIP67, belongs to the krueppel C2H2-type zinc-finger protein family. ZNF653 is a transcriptional repressor, which may repress NR5A1, PPARG, NR1H3, NR4A2, ESR1, and NR3C1 transcriptional activity. ZNF653 is highly expressed in testis, cerebellum, temporal lobe, hippocampus and adrenal gland, and moderately expressed in spleen, uterus, thymus, pancreas, kidney, stomach and rectum. The calculated molecular weight of ZNF653 is 67 kDa. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23904 Product name: Recombinant human ZNF653 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC014187 Sequence: MAERALEPEAEAEAEAGAGGEAAAEEGAAGRKARGRPRLTESDRARRRLESRKKYDVRRVYLGEAHGPWVDLRRRSGWSDAKLAAYLISLERGQRSGRHGKPWEQVPKKPKRKKRRRRNVNCLKNVVIWYEDHKHRCPYEPHLAELDPTFGLYTTAVWQCEAGHRYFQDLHSPLKPLSDSDPDSDKVGNGLVAGSSDSSSSGSASDSEESPEGQPVKAAAAAAAATPTSPVGSSGLITQEGVHIPFDVHHVESLAEQGTPLCSNPAGNGPEALETVVCVPVPVQVGAGPSALFENVPQEALGEVVASCPMPGMVPGSQVIIIAGPGYDALTAEGIHLNMAAGSGVPGSGL Predict reactive species Full Name: zinc finger protein 653 Observed Molecular Weight: 67 kDa GenBank Accession Number: BC014187 Gene Symbol: ZNF653 Gene ID (NCBI): 115950 RRID: AB_3669613 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96CK0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924