Proteintech, 27592-1-AP, RACK1; GNB2L1 Polyclonal antibody

Size: 20ul / 150ul The RACK1; GNB2L1 (27592-1-AP) by Proteintech is a Polyclonal antibody targeting RACK1; GNB2L1 in WB, IHC, ELISA applications with reactivity to Human, mouse, rat samples 27592-1-AP targets RACK1; GNB2L1 in WB, IHC, IF, IP, CoIP, RIP, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, L02 cells, HepG2 cells, rat liver tissue Positive IHC detected in: human liver cancer tissue, human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:400-1:1600 Background Information Members of the protein kinase C (PKC) family play a key regulatory role in a variety of cellular functions, including cell growth and differentiation, gene expression, hormone secretion and membrane function. RACK1 (receptor for activated protein kinase C 1), encoded by GNB2L1 gene, is a 317 amino acid guanine nucleotide-binding protein subunit beta-2-like 1 protein which is involved in the recruitment, assembly and/or regulation of a variety of signaling molecules, it contains 7 WD-repeats and is implicated in various protein interaction activities. RACK1 is a component of the 40S ribosomal subunit involved in translational repression. Recent finding suggests that RACK1 may be a new promising diagnosis biomarker and therapeutic target for non-small-cell lung cancer (NSCLC). Specification Tested Reactivity: Human, mouse, rat Cited Reactivity: human, mouse, pig, monkey Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26708 Product name: Recombinant human RACK1; GNB2L1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 131-317 aa of BC019093 Sequence: LWNTLGVCKYTVQDESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGKIIVDELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVWQVTIGTR Predict reactive species Full Name: guanine nucleotide binding protein (G protein), beta polypeptide 2-like 1 Calculated Molecular Weight: 36 kDa Observed Molecular Weight: 31 kDa GenBank Accession Number: BC019093 Gene Symbol: RACK1 Gene ID (NCBI): 10399 RRID: AB_2880917 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P63244 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.