Proteintech, 27594-1-AP, Glypican 2 Polyclonal antibody

Size: 20ul / 150ul The Glypican 2 (27594-1-AP) by Proteintech is a Polyclonal antibody targeting Glypican 2 in WB, ELISA applications with reactivity to mouse, rat samples 27594-1-AP targets Glypican 2 in WB, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: unboiled mouse brain tissue, unboiled rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information GPC2 (glypican 2), which is expected to be located in cell membrane and extracellular space. It is expressed in lymphoid tissue, skin and testis. The calculated molecular weight of the protein is 62 kDa. GPC2 is mainly active in growing nervous tissues and thyroid cancer tissues (PMID: 28616017). It participates in the growth and differentiation of neuronal axons. Increasing evidence has demonstrated the overexpression of GPC2 in neuroblastoma, a kind of childhood cancer. There is a discovery that GPC2 can be employed as a diagnostic, prognostic, and immunological predictor of generalized cancers. The study may broaden the train of thought toward application of GPC2 in immunotherapy (PMID: 35345673). Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26734 Product name: Recombinant human GPC2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 386-554 aa of BC027972 Sequence: NLHRLVWELRERLARMRGFWARLSLTVCGDSRMAADASLEAAPCWTGAGRGRYLPPVVGGSPAEQVNNPELKVDASGPDVPTRRRRLQLRAATARMKTAALGHDLDGQDADEDASGSGGGQQYADDWMAGAVAPPARPPRPPYPPRRDGSGGKGGGGSARYNQGRSRSG Predict reactive species Full Name: glypican 2 Calculated Molecular Weight: 579 aa, 63 kDa Observed Molecular Weight: 62-67 kDa GenBank Accession Number: BC027972 Gene Symbol: GPC2 Gene ID (NCBI): 221914 RRID: AB_3085972 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N158 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.