Proteintech, 27606-1-AP, RanBP2 Polyclonal antibody

Size: 20ul / 150ul The RanBP2 (27606-1-AP) by Proteintech is a Polyclonal antibody targeting RanBP2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 27606-1-AP targets RanBP2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, Ramos cells, Y79 cells Positive IHC detected in: rat liver tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information RanBP2 (Ran-binding protein 2) is also named as p270 and NUP358, and belongs to the RanBP2 E3 ligase family. RanBP2 is E3 SUMO-protein ligase which facilitates SUMO1 and SUMO2 conjugation by UBE2I (PMID:11792325, PMID:22194619). RanBP2 involved in transport factor (Ran-GTP, karyopherin)-mediated protein import via the F-G repeat-containing domain which acts as a docking site for substrates (PMID:7775481). It is component of the nuclear export pathway (PMID:10078529). RanBP2 recruits BICD2 to the nuclear envelope and cytoplasmic stacks of nuclear pore complex known as annulate lamellae during G2 phase of cell cycle (PMID:20386726). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26370 Product name: Recombinant human RANBP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2801-2900 aa of NM_006267 Sequence: MKSISSPSVSSETMDKPVDLSTRKEIDTDSTSQGESKIVSFGFGSSTGLSFADLASSNSGDFAFGSKDKNFQWANTGAAVFGTQSVGTQSAGKVGEDEDGS Predict reactive species Full Name: RAN binding protein 2 Calculated Molecular Weight: 358 kDa Observed Molecular Weight: 358 kDa GenBank Accession Number: NM_006267 Gene Symbol: RANBP2 Gene ID (NCBI): 5903 RRID: AB_2880923 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P49792 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.