Iright
BRAND / VENDOR: Proteintech

Proteintech, 27615-1-AP, E2F3 Polyclonal antibody

CATALOG NUMBER: 27615-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The E2F3 (27615-1-AP) by Proteintech is a Polyclonal antibody targeting E2F3 in WB, ELISA applications with reactivity to human samples 27615-1-AP targets E2F3 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: SGC-7901 cells, SKOV-3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information E2F transcription factors regulate gene expression in concert with the retinoblastoma tumor suppressor family. These transcriptional complexes are master regulators of cell cycle progression, control the expression of genes involved in DNA repair, G2/M checkpoint and differentiation [PMID:22580460]. E2f3 is a transcription activator that binds DNA cooperatively with DP proteins through the E2 recognition site, 5'-TTTC[CG]CGC-3' found in the promoter region of a number of genes whose products are involved in cell cycle regulation or in DNA replication. The DRTF1/E2F complex functions in the control of cell-cycle progression from G1 to S phase. E2F3 binds specifically to RB1 in a cell-cycle dependent manner [PMID:22960857]. Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26367 Product name: Recombinant human E2F3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 54-155 aa of NM_001243076 Sequence: MPGAYIQILTTNTSTTSCSSSLQSGAVAAGPLLPSAPGAEQTAGSLLYTTPHGPSSRAGLLQQPPALGRGGSGGGGGPPAKRRLELGESGHQYLSDGLKTPKG Predict reactive species Full Name: E2F transcription factor 3 Calculated Molecular Weight: 49 kDa Observed Molecular Weight: 60-65 kDa GenBank Accession Number: NM_001243076 Gene Symbol: E2F3 Gene ID (NCBI): 1871 RRID: AB_2880926 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O00716 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924