Proteintech, 27622-1-AP, HOXA5 Polyclonal antibody

Size: 20ul / 150ul The HOXA5 (27622-1-AP) by Proteintech is a Polyclonal antibody targeting HOXA5 in WB, IF/ICC, IP, ELISA applications with reactivity to human samples 27622-1-AP targets HOXA5 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, HEK-293 cells Positive IP detected in: HEK-293 cells Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information HOXA5 (Homeobox A5) is a member of the homeobox gene family, which plays a crucial role in embryonic development, cell differentiation, and tissue patterning (PMID: 31159758). These genes encode transcription factors containing a conserved homeodomain that binds DNA to regulate the expression of target genes involved in morphogenesis and organogenesis. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26362 Product name: Recombinant human HOXA5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 64-163 aa of BC013682 Sequence: FGSGERARSYAASASAAPAEPRYSQPATSTHSPQPDPLPCSAVAPSPGSDSHHGGKNSLSNSSGASADAGSTHISSREGVGTASGAEEDAPASSEQASAQ Predict reactive species Full Name: homeobox A5 Calculated Molecular Weight: 270 aa, 29 kDa Observed Molecular Weight: 38-42 kDa GenBank Accession Number: BC013682 Gene Symbol: HOXA5 Gene ID (NCBI): 3202 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P20719 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.