Iright
BRAND / VENDOR: Proteintech

Proteintech, 27623-1-AP, DBNDD2 Polyclonal antibody

CATALOG NUMBER: 27623-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DBNDD2 (27623-1-AP) by Proteintech is a Polyclonal antibody targeting DBNDD2 in WB, IHC, ELISA applications with reactivity to Human, mouse, rat samples 27623-1-AP targets DBNDD2 in WB, IHC, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: SH-SY5Y cells, mouse brain tissue, rat brain tissue Positive IHC detected in: rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: Human, mouse, rat Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26356 Product name: Recombinant human DBNDD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 60-161 aa of BC001105 Sequence: DTLEQVELIDLGDPDAADVFLPCEDPPPTPQSSGMDNHLEELSLPVPTSDRTTSRTSSSSSSDSSTNLHSPNPSDDGADTPLAQSDEEEERGDGGAEPGACS Predict reactive species Full Name: dysbindin (dystrobrevin binding protein 1) domain containing 2 Calculated Molecular Weight: 261 aa, 28 kDa Observed Molecular Weight: 28-29 kDa GenBank Accession Number: BC001105 Gene Symbol: DBNDD2 Gene ID (NCBI): 55861 RRID: AB_2880927 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BQY9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924