Product Description
Size: 20ul / 150ul
The DBNDD2 (27623-1-AP) by Proteintech is a Polyclonal antibody targeting DBNDD2 in WB, IHC, ELISA applications with reactivity to Human, mouse, rat samples
27623-1-AP targets DBNDD2 in WB, IHC, ELISA applications and shows reactivity with Human, mouse, rat samples.
Tested Applications
Positive WB detected in: SH-SY5Y cells, mouse brain tissue, rat brain tissue
Positive IHC detected in: rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:1000-1:4000
Immunohistochemistry (IHC): IHC : 1:50-1:500
Specification
Tested Reactivity: Human, mouse, rat
Cited Reactivity: human, rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag26356 Product name: Recombinant human DBNDD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 60-161 aa of BC001105 Sequence: DTLEQVELIDLGDPDAADVFLPCEDPPPTPQSSGMDNHLEELSLPVPTSDRTTSRTSSSSSSDSSTNLHSPNPSDDGADTPLAQSDEEEERGDGGAEPGACS Predict reactive species
Full Name: dysbindin (dystrobrevin binding protein 1) domain containing 2
Calculated Molecular Weight: 261 aa, 28 kDa
Observed Molecular Weight: 28-29 kDa
GenBank Accession Number: BC001105
Gene Symbol: DBNDD2
Gene ID (NCBI): 55861
RRID: AB_2880927
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q9BQY9
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924