Product Description
Size: 20ul / 150ul
The Claudin 16 (27638-1-AP) by Proteintech is a Polyclonal antibody targeting Claudin 16 in WB, ELISA applications with reactivity to human, canine samples
27638-1-AP targets Claudin 16 in WB, ELISA applications and shows reactivity with human, canine samples.
Tested Applications
Positive WB detected in: A549 cells, HepG2 cells, HEK-293 cells, MDCK cells
Recommended dilution
Western Blot (WB): WB : 1:1000-1:4000
Specification
Tested Reactivity: human, canine
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag26531 Product name: Recombinant human CLDN16 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-73 aa of BC069682 Sequence: MTSRTPLLVTACLYYSYCNSRHLQQGVRKSKRPVFSHCQVPETQKTDTRHLSGARAGVCPCCHPDGLLATMRD Predict reactive species
Full Name: claudin 16
Calculated Molecular Weight: 305 aa, 34 kDa
Observed Molecular Weight: 34 kDa
GenBank Accession Number: BC069682
Gene Symbol: CLDN16
Gene ID (NCBI): 10686
RRID: AB_2880935
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q9Y5I7
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924