Iright
BRAND / VENDOR: Proteintech

Proteintech, 27657-1-AP, TAPT1 Polyclonal antibody

CATALOG NUMBER: 27657-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TAPT1 (27657-1-AP) by Proteintech is a Polyclonal antibody targeting TAPT1 in WB, IHC, ELISA applications with reactivity to Human, mouse samples 27657-1-AP targets TAPT1 in WB, IHC, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive WB detected in: NIH/3T3 cells, mouse testis tissue Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: Human, mouse Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26360 Product name: Recombinant human TAPT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 257-402 aa of BC066899 Sequence: MVQATTLNVAFNSHNKSLLTIMMSNNFVEIKGSVFKKFEKNNLFQMSNSDIKERFTNYVLLLIVCLRNMEQFSWNPDHLWVLFPDVCMVIASEIAVDIVKHAFITKFNDITADVYSEYRASLAFDLVSSRQKNAYTDYSDSVARRM Predict reactive species Full Name: transmembrane anterior posterior transformation 1 Calculated Molecular Weight: 567 aa, 64 kDa Observed Molecular Weight: 65~70 kDa GenBank Accession Number: BC066899 Gene Symbol: TAPT1 Gene ID (NCBI): 202018 RRID: AB_2880940 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6NXT6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924