Proteintech, 27675-1-AP, MUC2 Polyclonal antibody

Size: 20ul / 150ul The MUC2 (27675-1-AP) by Proteintech is a Polyclonal antibody targeting MUC2 in IHC, IF/ICC, IF-P, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 27675-1-AP targets MUC2 in WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: human colon tissue, human pancreas cancer tissue, mouse small intestine tissue, rat small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human colon tissue, mouse colon tissue, rat small intestine tissue Positive IF/ICC detected in: HepG2 cells, SW480 cells Positive FC (Intra) detected in: MCF-7 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.13 ug per 10^6 cells in a 100 µl suspension Background Information This gene encodes a member of the mucin protein family. Mucins are high molecular weight glycoproteins produced by many epithelial tissues. The protein encoded by this gene is secreted and forms an insoluble mucous barrier that protects the gut lumen. The protein polymerizes into a gel of which 80% is composed of oligosaccharide side chains by weight. Downregulation of this gene has been observed in patients with Crohn disease and ulcerative colitis. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig, chicken, duck, mosquito Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25800 Product name: Recombinant human MUC2 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 726-850 aa of M94132 Sequence: MYLEAGDVVVRQEERCVCRDGRLHCRQIRLIGQSCTAPKIHMDCSNLTALATSKPRALSCQTLAAGYYHTECVSGCVCPDGLMDDGRGGCVVEKECPCVHNNDLYSSGAKIKVDCNTCTCKRGRWV Predict reactive species Full Name: mucin 2, oligomeric mucus/gel-forming Calculated Molecular Weight: 540 kDa GenBank Accession Number: M94132 Gene Symbol: MUC2 Gene ID (NCBI): 4583 RRID: AB_2880943 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q02817 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.