Proteintech, 27694-1-AP, TIAM1 Polyclonal antibody

Size: 20ul / 150ul The TIAM1 (27694-1-AP) by Proteintech is a Polyclonal antibody targeting TIAM1 in WB, ELISA applications with reactivity to Human, mouse samples 27694-1-AP targets TIAM1 in WB, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive WB detected in: HEK-293T cells, HCT 116 cells, Neuro-2a cells Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Specification Tested Reactivity: Human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26777 Product name: Recombinant human TIAM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 823-1002 aa of NM_003253 Sequence: MQPEEDIYELLYKEIEICPKVTQSIHIEKSDTAADTYGFSLSSVEEDGIRRLYVNSVKETGLASKKGLKAGDEILEINNRAADALNSSMLKDFLSQPSLGLLVRTYPELEEGVELLESPPHRVDGPADLGESPLAFLTSNPGHSLCSEQGSSAETAPEETEGPDLESSDETDHSSKSTEQV Predict reactive species Full Name: T-cell lymphoma invasion and metastasis 1 Calculated Molecular Weight: 178 kDa Observed Molecular Weight: 178 kDa GenBank Accession Number: NM_003253 Gene Symbol: TIAM1 Gene ID (NCBI): 7074 RRID: AB_2918127 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13009 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.