Iright
BRAND / VENDOR: Proteintech

Proteintech, 27708-1-AP, TMEM85 Polyclonal antibody

CATALOG NUMBER: 27708-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TMEM85 (27708-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM85 in WB, IHC, ELISA applications with reactivity to Human, Mouse, rat samples 27708-1-AP targets TMEM85 in WB, IHC, ELISA applications and shows reactivity with Human, Mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HepG2 cells, mouse heart tissue, rat heart tissue Positive IHC detected in: human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: Human, Mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26785 Product name: Recombinant human TMEM85 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-70 aa of BC002583 Sequence: MTAQGGLVANRGRRFKWAIELSGPGGGSRGRSDRGSGQGDSLYPVGYLDKQVPDTSVQETDRILVEKRCW Predict reactive species Full Name: transmembrane protein 85 Observed Molecular Weight: 20 kDa GenBank Accession Number: BC002583 Gene Symbol: TMEM85 Gene ID (NCBI): 51234 RRID: AB_2880950 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5J8M3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924