Proteintech, 27726-1-AP, ABCB4 Polyclonal antibody

Size: 20ul / 150ul The ABCB4 (27726-1-AP) by Proteintech is a Polyclonal antibody targeting ABCB4 in WB, ELISA applications with reactivity to human samples 27726-1-AP targets ABCB4 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, MCF-7 cells, L02 cells, MDA-MB-231 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Background Information ABCB4, also known as MDR3, is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABCB4 is expressed on the apical membrane of hepatocytes and functions to transport phosphatidylcholine (PC) from hepatocytes into the bile canaliculus (PMID: 16622704). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26840 Product name: Recombinant human ABCB4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 628-706 aa of BC042531 Sequence: VNMQTSGSQIQSEEFELNDEKAATRMAPNGWKSRLFRHSTQKNLKNSQMCQKSLDVETDGLEANVPPVSFLKVLKLNKT Predict reactive species Full Name: ATP-binding cassette, sub-family B (MDR/TAP), member 4 Calculated Molecular Weight: 1286 aa, 142 kDa Observed Molecular Weight: 130-140 kDa GenBank Accession Number: BC042531 Gene Symbol: ABCB4 Gene ID (NCBI): 5244 RRID: AB_2918128 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P21439 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.