Iright
BRAND / VENDOR: Proteintech

Proteintech, 27729-1-AP, Flightless I Polyclonal antibody

CATALOG NUMBER: 27729-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Flightless I (27729-1-AP) by Proteintech is a Polyclonal antibody targeting Flightless I in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 27729-1-AP targets Flightless I in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells, HeLa cells, THP-1 cells, T-47D cells Positive IHC detected in: human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Flightless I (FliI) is the most evolutionarily conserved member of the gelsolin superfamily of proteins which are key regulators of actin filament assembly and turnover. FliI comprises an N-terminal leucine-rich repeat (LRR) domain which is not present in other gelsolin family members, and the LRR domain may enable interactions between FliI and other molecules involved in signal transduction, thereby spatially integrating signaling and actin remodeling functions. This protein was originally found in Drosophila and participates in the embryonic development, while mammalian FliI protein was involved in the regulation of wound repair,skin barrier development. Studies recently demonstrated that FliI protein associated with colorectal cancer, hepatocellular and prostate cancer (PMID:30091651; 28498392). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26865 Product name: Recombinant human FLII protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 440-900 aa of BC025300 Sequence: DQAKQVLKGMSDVAQEKNKKQEESADARAPSGKVRRWDQGLEKPRLDYSEFFTEDVGQLPGLTIWQIENFVPVLVEEAFHGKFYEADCYIVLKTFLDDSGSLNWEIYYWIGGEATLDKKACSAIHAVNLRNYLGAECRTVREEMGDESEEFLQVFDNDISYIEGGTASGFYTVEDTHYVTRMYRVYGKKNIKLEPVPLKGTSLDPRFVFLLDRGLDIYVWRGAQATLSSTTKARLFAEKINKNERKGKAEITLLVQGQELPEFWEALGGEPSEIKKHVPEDFWPPQPKLYKVGLGLGYLELPQINYKLSVEHKQRPKVELMPRMRLLQSLLDTRCVYILDCWSDVFIWLGRKSPRLVRAAALKLGQELCGMLHRPRHATVSRSLEGTEAQVFKAKFKNWDDVLTVDYTRNAEAVLQSPGLSGKVKRDAEKKDQMKADLTALFLPRQPPMSLAEAEQLMEEW Predict reactive species Full Name: flightless I homolog (Drosophila) Calculated Molecular Weight: 1269 aa, 145 kDa Observed Molecular Weight: 145-150 kDa GenBank Accession Number: BC025300 Gene Symbol: Flightless I Gene ID (NCBI): 2314 RRID: AB_3085990 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13045 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924