Proteintech, 27747-1-AP, SLC24A5 Polyclonal antibody

Size: 20ul / 150ul The SLC24A5 (27747-1-AP) by Proteintech is a Polyclonal antibody targeting SLC24A5 in WB, IHC, ELISA applications with reactivity to Human, mouse, rat samples 27747-1-AP targets SLC24A5 in WB, IHC, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: mouse eye tissue, A375 cells, rat eye tissue Positive IHC detected in: human thyroid cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Specification Tested Reactivity: Human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24254 Product name: Recombinant human SLC24A5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 412-500 aa of BC113628 Sequence: LCLGIPWFIKTAFINGSAPAEVNSRGLTYITISLNISIIFLFLAVHFNGWKLDRKLGIVCLLSYLGLATLSVLYELGIIGNNKIRGCGG Predict reactive species Full Name: solute carrier family 24, member 5 Calculated Molecular Weight: 500 aa, 55 kDa Observed Molecular Weight: 45-50 kDa GenBank Accession Number: BC113628 Gene Symbol: SLC24A5 Gene ID (NCBI): 283652 RRID: AB_2880959 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q71RS6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.