Proteintech, 27768-1-AP, GET4 Polyclonal antibody

Size: 20ul / 150ul The GET4 (27768-1-AP) by Proteintech is a Polyclonal antibody targeting GET4 in WB, IHC, ELISA applications with reactivity to human samples 27768-1-AP targets GET4 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, MCF-7 cells, HeLa cells Positive IHC detected in: human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26904 Product name: Recombinant human C7orf20 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 5-141 aa of BC003550 Sequence: AAAPNPADGTPKVLLLSGQPASAAGAPAGQALPLMVPAQRGASPEAASGGLPQARKRQRLTHLSPEEKALRRKLKNRVAAQTARDRKKARMSELEQQVVDLEEENQKLLLENQLLREKTHGLVVENQELRQRLGMDA Predict reactive species Full Name: chromosome 7 open reading frame 20 Calculated Molecular Weight: 327 aa, 37 kDa Observed Molecular Weight: 33 kDa GenBank Accession Number: BC003550 Gene Symbol: GET4 Gene ID (NCBI): 51608 RRID: AB_2880967 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q7L5D6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.