Proteintech, 27776-1-AP, RIC3 Polyclonal antibody

Size: 20ul / 150ul The RIC3 (27776-1-AP) by Proteintech is a Polyclonal antibody targeting RIC3 in WB, ELISA applications with reactivity to Human, mouse samples 27776-1-AP targets RIC3 in WB, IHC, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive WB detected in: mouse heart tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: Human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26740 Product name: Recombinant human RIC3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 117-369 aa of BC022455 Sequence: KLSKGKTTAEDGKCYTAMPGNTHRKITSFELAQLQEKLKETEAAMEKLFNRVGPNGERAQTVTSDQEKRLLHQLREITRVMKEGKFIDRFSPEKEAEEAPYMEDWEGYPEETYPIYDLSDCIKRRQETILVDYPDPKELSAEEIAERMGMIEEEESDHLGWESLPTDPRAQEDNSVTSCDPKPETCSCCFHEDEDPAVLAENAGFSADSYPEQEETTKEEWSQDFKDEGLGISTDKAYTGSMLRKRNPQGLE Predict reactive species Full Name: resistance to inhibitors of cholinesterase 3 homolog (C. elegans) Calculated Molecular Weight: 368 aa, 41 kDa Observed Molecular Weight: 41 kDa GenBank Accession Number: BC022455 Gene Symbol: RIC3 Gene ID (NCBI): 79608 RRID: AB_2880969 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q7Z5B4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.