Iright
BRAND / VENDOR: Proteintech

Proteintech, 27787-1-AP, PNPLA7 Polyclonal antibody

CATALOG NUMBER: 27787-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PNPLA7 (27787-1-AP) by Proteintech is a Polyclonal antibody targeting PNPLA7 in IHC, ELISA applications with reactivity to human, mouse samples 27787-1-AP targets PNPLA7 in IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information PNPLA7 (Patatin-like phospholipase domain-containing protein 7), also termed NTE-related 1 (NTE-R1) or NRE, is a member of the PNPLAs family, which is conserved protein in mice, rats and humans. It serves key roles in triglyceride hydrolysis, energy metabolism, lipid droplet (LD), and in regulation of adipocyte differentiation. It is reported that PNPLA7 was down-regulated in HCC through hypermethylation of its promoter, which indicates that PNPLA7 may be a potential biomarker for HCC diagnosis (PMID: 16799181, 27347198). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27184 Product name: Recombinant human PNPLA7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 302-468 aa of NM_001098537 Sequence: MVSVASVAAGKAKKQVFYGEEERLKKPPRLQESCDSDHGGGRPAAAGPLLKRSHSVPAPSIRKQILEELEKPGAGDPDPSAPQGGPGSATSDLGMACDRARVFLHSDEHPGSSVASKSRKSVMVAEIPSTVSQHSESHTDETLASRKSDAIFRAAKKDLLTLMKLEDS Predict reactive species Full Name: patatin-like phospholipase domain containing 7 Calculated Molecular Weight: 146 kDa GenBank Accession Number: NM_001098537 Gene Symbol: PNPLA7 Gene ID (NCBI): 375775 RRID: AB_3669623 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6ZV29 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924